PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S00331.80
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family Nin-like
Protein Properties Length: 807aa    MW: 91276.6 Da    PI: 6.3561
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S00331.80genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.99.5e-29518569152
         RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                    aek+isl+ l++yF++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  Jcr4S00331.80 518 AEKTISLQILRQYFAGSLKDAAKSIGVCPTTLKRICRQHGINRWPSRKIKKV 569
                    589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.824508589IPR003035RWP-RK domain
PfamPF020421.4E-24521569IPR003035RWP-RK domain
SuperFamilySSF542779.6E-19719800No hitNo description
PROSITE profilePS5174520.208719802IPR000270PB1 domain
SMARTSM006662.0E-19719802IPR000270PB1 domain
PfamPF005644.5E-14720799IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2401.9E-20720799No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 807 aa     Download sequence    Send to blast
MDRGASALIN STFSSTSVDL DFIDKPFAHG SWLRTTDKVN FLESAPFISS VQYLDSYHQF  60
SRKEMENLFD NPTPVYSGIG KCVVETDTCL VQSQGEESRT RKFLIEPYCS VKDRLTLAID  120
YLKEYVEHRD VLIQIWVPTK IAGQNVLTAT DLPYSLNPSC WSLESYRNIS KAFHLTAEDS  180
KESAGLPGRV SWKSFLNGLL IGCLALPVFE QESGTCLAVV EIVTTTQKIN YHLELEIVCK  240
ALEAVDLKSS QDFFPFCIKT CNEFYQIAIP EISKILKSVC ETNNLPLALT WALCNRQGKN  300
EYEQVSGKYD YYISTVDSAC YMADSDLFGF YKACSTQYLF LDQGIVGKAF TRNKQLFATD  360
VTSFSKTSYP LSHHARMFNL RAALAIPLAN IYTGSIEFVL EIFLPRDCQD IEEQKHMWDF  420
LPIVIQHSCR NFHVIMDKEK ENFAFVSWEC LKEEPEEEFK VISHWDNNES EFSEFEQLQE  480
SSALKFGVVD ESKENSSVGI DFSLSKNLRA GEKRQTKAEK TISLQILRQY FAGSLKDAAK  540
SIGVCPTTLK RICRQHGINR WPSRKIKKVN HSLKKLQLVV NSIRGAEGLI RIDSFYNTFP  600
GLNSQGNDHF PSFKTNNNSQ KLNSQPDSGL LSLKVADSNS QSPSGSQNSG SSICCSTKAK  660
QLTSTTTNGL NTAFSLAVEV PVVTLNRSCS KAELLSPNHD KIQETIPKVT GQSFRDGMIF  720
RVKATFGLEN IRFSFQPNWA FKDLQQEIAK RFKIYDFSKI DLKYLDIDQE SVLLTCDDDL  780
DECLDLLRFS QTNTLKISLY QSSQPKI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002532423.10.0PREDICTED: protein NLP2 isoform X1
RefseqXP_015582869.10.0PREDICTED: protein NLP2 isoform X1
TrEMBLA0A067LB880.0A0A067LB88_JATCU; Uncharacterized protein
STRINGPOPTR_0009s16830.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12373399
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.11e-176Nin-like family protein